Involved in the transcriptional regulation of genes required for mesoderm differentiation, including itself. Indispensable for the formation of the notochord and the tail structure. Functions together with tbx16/spadetail in development of trunk and tail mesoderm. Functions by itself early in development to repress medial floor plate and promote notochord fate but at later times, functions together with tbx16/spadetail to promote medial floor plate formation. Acts in a parallel pathway to, but cooperates with, non-canonical wnt-signaling during tail formation. Required for the morphogenesis of Kupffer's vesicle and regulates left-right asymmetry.

423 amino acids

MSASSPDQRLDHLLSAVESEFQKGSEKGDASERDIKLSLEDAELWTKFKELTNEMIVTKTGRRMFPVLRASVTGLDPNAMYSVLLDFVAADNNRWKYVNGEWVPGGKPEPQSPSCVYIHPDSPNFGAHWMKAPVSFSKVKLSNKLNGGGQIMLNSLHKYEPRIHIVKVGGIQKMISSQSFPETQFIAVTAYQNEEITALKIKHNPFAKAFLDAKERSDHKEVPDHSTDNQQSGYSQLGGWFLPSNGPMGPSSSPPQFNGAPVHSSGSYCERYSSLRNHRAAPYPSHYSHRSTTTNNYMDNSSGSLASHDSWSALQIPNSSGMGTLAHTTNTTSNTSQYPSLWSVAGTTLTPSGSASGSITGGLTSQFLRGSSMSYSGLTSSLPVSSPSSMYDPGLSEVGVGDAQFESSIARLTASWAPVAQSY

45.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tbxta using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here