Component of TORC1 complex, which is an essential cell growth regulator that controls plant development. Acts by activating transcription, protein synthesis and ribosome biogenesis, and inhibiting mRNA degradation and autophagy (Probable). Involved in regulating amino acid accumulation and the synthesis of myo-inositol and raffinose during plant adaptation to long days (PubMed:22307851). Involved in the regulation of plant growth and abscisic acid (ABA) accumulation. Acts as positive regulation of the ABA biosynthetic genes ZEP, NCED3 and AAO3, and negative regulator of the ABA catabolic genes CYP707A2 and CYP707A3 (PubMed:26459592).

Belongs to the WD repeat LST8 family.

305 amino acids

MSQPSVILATASYDHTIRFWEAETGRCYRTIQYPDSHVNRLEITPDKHYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNNVMAVGFQCDAKWMYSGSEDGTVKIWDLRAPGCQKEYESVAAVNTVVLHPNQTELISGDQNGNIRVWDLRANSCSCELVPEVDTAVRSLTVMWDGTMVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTVKIWNVDGFKLEKVLTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHKATVCCALHD

34.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make LST8-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here