Essential component of the TORC2 complex, which plays a critical role in akt1 'Ser-473' phosphorylation, and may modulate the phosphorylation of pkca and regulate actin cytoskeleton organization. May interact with a MAP kinase. May act on Ras-regulated pathways (By similarity).

Belongs to the SIN1 family.

520 amino acids

MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDIDLEKLYQSSVPGENSTQMQSNGGETQGYVYSQSVDITSSWDFGIRRRSNTAQKLERLRKERQNQIKCKNVQWKDRNTSHSAEELGSLFERKNFKERDLNHGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLSMQTSQDKLLPMTVVTIANAKVHDLIGLICWQYTTESREPKLNDNVDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLAAKQSLFVRINAAHGFSLIQVDSTNVTMQEILEKALKRRKGSQRNSGPQYRLEKQSQPNVPVDLDSTLESQNSLEFCLVRENSSRGEEHPEEETQIDIATVQDMLSSHQYKSFKVSMIHRLRFTTDVQLGISGEKVEIDPVTNQKTSTKFWIKQKPISIDSDLLCACDLAEEKSPSHAMFKVTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLTRRTSFSFQKEKKTG

59.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mapkap1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here