Acts as chaperone and promotes the dimerization of transcription factors containing basic leucine zipper (bZIP) domains and thereby promotes transcriptional activation.

Belongs to the ALYREF family.

254 amino acids

MADKMDMSLDDIIKLNRSQRGASRGGRGGRGRGGTARGGGPGRGGVGGGRAGGGPVRNRPVMARGGGRNRPAPYSRPKQLPEKWQHDLFDSGFGAGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDTQRRPAQSVNRGGMTRNRGVLGGFGGGGNRRGTRGGNRGRGRGAGRTSKQQLSAEELDAQLDAYNARMDTS

26.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ALYREF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here