May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. May mediate Ca(2+)-regulation of exocytosis in acrosomal reaction in sperm (By similarity).

Belongs to the synaptotagmin family.

511 amino acids

MSGVWGAGGPRCQAALAVLASLCRARPPPLGLDVETCQSFELQPPEQSPSAADSGTSVSLLAVVVIVCGVALVAVFFFLFWKLCWMPWRNKEASSPSSANPASEILQSPSSRGNMADKLKDPSALGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTKLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAAEQPTSIGRIKPELYKQKSVDGDEAKSEAAKSCGKINFSLRYDYESETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGISAEGLGRDHWNEMLAYPRKPIAHWHCLAEVKKSFKEGTPRL

57.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Syt6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here