Involved in the targeting and/or fusion of transport vesicles to their target membrane. Acts in neuronal exocytosis of synaptic transmission. Likely to have a role in cholinergic transmisson. Required for viability, coordinated movement and M3 pharynx motor neuron function (By similarity).

Belongs to the synaptobrevin family.

108 amino acids

MDAQGDAGAQGGSQGPRPSNKRLQQTQAQVDEVVGIMKVNVEKVLERDQKLSQLDDRADALQEGASQFEKSAATLKRKYWWKNIKMMIIMCAIVVILIIIIVLWAGGK

12 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make snb-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here