Acts as suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Forms a homodimer to measure siRNA duplex in a length-preference mode. Binds to both siRNA duplexes (19bp) and long siRNA duplexes (30bp).

Belongs to the cucumovirus/ilarvirus protein 2b family.

95 amino acids

MASIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELSAINSDNSSDEGTTLCRFDTFGSKSDAICDRSDWCLDQ

11.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ORF2b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here