Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity). Protects spores from cellular damage caused by UV LIGHT.

Belongs to the Cu-Zn superoxide dismutase family.

151 amino acids

MVKAICVVKGAVVNGTIIFSQENEGSPVYVNGTISGLSGGLHGFHIHEFGDTSNGCLSAGAHFNPFHVEHGGPNSAIRHVGDLGNITSCPSSKVANVLIQDNVISLFGDLSIIGRTLVVHENQDDLGLGGNLSKTTGNAGARVACGILAKI

15.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sodD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here