Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Probably involved in the protection against oxidative stress during pollen development.

Belongs to the Cu-Zn superoxide dismutase family.

152 amino acids

MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHSDPDDLGRGGHELSKSTGNAGGRVACGIIGLQG

15.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OLE5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here