Description
Sulfur carrier protein involved in sulfur trafficking in the cell. Part of a sulfur-relay system required for 2-thiolation during synthesis of 2-thiouridine of the modified wobble base 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) in tRNA. Interacts with IscS and stimulates its cysteine desulfurase activity. Accepts an activated sulfur from IscS, which is then transferred to TusD, and thus determines the direction of sulfur flow from IscS to 2-thiouridine formation. Also appears to be involved in sulfur transfer for the biosynthesis of molybdopterin.
Family
Belongs to the sulfur carrier protein TusA family.
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Sequence
MTDIFANPDKTLDALGLRCPEPVMMVRKTVRHMEEGQTLLIIADDPATTRDIPGFCRFMDHQLLAQDTEQTPYRYLVRKGITAG
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service