About Products Protein Database Contact

Protein expression services for dsrE2 | Sulfur carrier protein DsrE2

Description
Sulfur carrier protein probably involved in sulfur trafficking for oxidative dissimilatory sulfur metabolism. May be a component of a cytoplasmic sulfur relay system delivering sulfur to DsrC. Binds sulfur in the presence of sulfide in vitro.
Species
Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Length
159 amino acids
Sequence
MEQKKLAIIATKGSLDWAYPPFILASTAAALGYEVQVFFTFYGLQLLKKKPNLEVTPLGNPGMPMPMGMDKWFPVLGLALPGMQGMMTAMMKQKMKSKGVASIEELRELCQEAEVKMIACQMTVDLFDMPKAEFIDGVEYAGAAAFFEFAGESDICLYI
Mass
17.6 kDa
Simulated SDS-PAGE
Western blot of dsrE2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make dsrE2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here