Sulfur carrier protein probably involved in sulfur trafficking for oxidative dissimilatory sulfur metabolism. May be a component of a cytoplasmic sulfur relay system delivering sulfur to DsrC. Binds sulfur in the presence of sulfide in vitro.

159 amino acids

MEQKKLAIIATKGSLDWAYPPFILASTAAALGYEVQVFFTFYGLQLLKKKPNLEVTPLGNPGMPMPMGMDKWFPVLGLALPGMQGMMTAMMKQKMKSKGVASIEELRELCQEAEVKMIACQMTVDLFDMPKAEFIDGVEYAGAAAFFEFAGESDICLYI

17.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dsrE2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here