Part of the SoeABC complex that catalyzes the oxidation of sulfite to sulfate. SoeC probably anchors and stabilizes the catalytic subunits.

Belongs to the DmsC family.

325 amino acids

MHPAFSVIFLTTLLGAGQGLYLAMVTGQLYAVARFLPAQADQFYAVGSLVALLLLIAGLGASFFHLGRPERAWRAAAMWRTSWLSREVIVLPIVMALVFAYGVAHWFEWTQPLFQVGAALQVDLTLLLGVLGTIASLALFVCTAMIYAAVRFLQEWHTPLTVSNFLFLGAASGFMLAAAYSAYIGNPLVTFYGTWAVILTLVGLASRLAHLRRNARLKHKSTVQTAIGVRHASVVQKAQGATGGSFNTREFFHGRSQSLLERLRTVYLVLVFPIPVLLIGLSYLIGSSNLPIIAFFVQFAGLLIERWSFFAEARHPQNLYYQSVA

35.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make soeC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here