Description
Part of a bifunctional enzyme complex that functions as a hydrogen-evolving hydrogenase with sulfur-reducing activity. May play a role in hydrogen cycling during fermentative growth. Activity exhibited with NAD in addition to NADPH. The beta and gamma subunits form the sulfur-reducing component that catalyzes the cytoplasmic production of hydrogen sulfide in the presence of elemental sulfur.
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Sequence
MNPYRSYDARIIEVKELTSREKLFSLKFLDNEIEENFTFKPGQFVIVDIRGFGEFPISLCSSPTRRPIQLCIRRVGRMTKFIHKMNEGDIIGIRGPYGNGFPMDLMEGSNLILIAGGLGMAPLRSVLWYAIDSGKYEKIYLFYGTKSYEDILFRDEIIHLLKHGEKLNCHVKLAYEVETPSCIYLERGFSEKVCKGVVTDLFRGEEFDVENSYALICGPPVMYKYVIRELLDRGLSPGRIYMTLERRMRCGVGKCGHCIVGTSVSIKYICKDGPVFTYWDALSTRGLI
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service