Part of a bifunctional enzyme complex that functions as a hydrogen-evolving hydrogenase with sulfur-reducing activity. May play a role in hydrogen cycling during fermentative growth. Activity exhibited with NAD in addition to NADPH. The beta and gamma subunits form the sulfur-reducing component that catalyzes the cytoplasmic production of hydrogen sulfide in the presence of elemental sulfur.

288 amino acids

MNPYRSYDARIIEVKELTSREKLFSLKFLDNEIEENFTFKPGQFVIVDIRGFGEFPISLCSSPTRRPIQLCIRRVGRMTKFIHKMNEGDIIGIRGPYGNGFPMDLMEGSNLILIAGGLGMAPLRSVLWYAIDSGKYEKIYLFYGTKSYEDILFRDEIIHLLKHGEKLNCHVKLAYEVETPSCIYLERGFSEKVCKGVVTDLFRGEEFDVENSYALICGPPVMYKYVIRELLDRGLSPGRIYMTLERRMRCGVGKCGHCIVGTSVSIKYICKDGPVFTYWDALSTRGLI

32.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make shyC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here