About Products Protein Database Contact

Protein expression services for SUT1 | Sucrose transport protein SUT1

Description
Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport other glucosides such as maltose, salicin, helicin, and alpha-phenylglucoside. Probably required for apoplastic phloem sucrose loading in source tissues (e.g. leaves) in order to transport it to sink tissues (e.g. roots, flowers). Probably not involved in transport of sugars across the symplastic discontinuity between the endosperm and the embryo. Essential for normal pollen germination, but not for pollen maturation or starch accumulation in pollen.
Family
Belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2.4) family.
Species
Oryza sativa subsp. japonica
Length
538 amino acids
Sequence
MARGSGAGGGGGGGGGGLELSVGVGGGGGARGGGGGEAAAAVETAAPISLGRLILSGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWLCGPIAGMVVQPCVGLYSDRCTSKWGRRRPYILTGCVLICLAVVVIGFSADIGYAMGDTKEDCSVYHGSRWHAAIVYVLGFWLLDFSNNTVQGPARALMADLSGRHGPGTANSIFCSWMAMGNILGYSSGSTNNWHKWFPFLKTRACCEACANLKGAFLVAVIFLSLCLVITLIFAKEVPFKGNAALPTKSNEPAEPEGTGPLAVLKGFRNLPTGMPSVLIVTGLTWLSWFPFILYDTDWMGREIYHGDPKGTDPQIEAFNQGVRAGAFGLLLNSIVLGFSSFLIEPMCRKVGPRVVWVTSNFLVCIAMAATALISFWSLKDFHGTVQKAITADKSIKAVCLVLFAFLGVPLAVLYSVPFAVTAQLAATRGGGQGLCTGVLNISIVIPQVVIALGAGPWDELFGKGNIPAFGLASGFALIGGVAGIFLLPKISKRQFRSVSMGGGH
Mass
56.2 kDa
Simulated SDS-PAGE
Western blot of SUT1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make SUT1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here