About Products Protein Database Contact

Protein expression services for AFUA_2G05090 | Succinate dehydrogenase assembly factor 3, mitochondrial

Description
Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.
Family
Belongs to the complex I LYR family. SDHAF3 subfamily.
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)
Length
129 amino acids
Sequence
MRLFHRLLMATPSTMGSKSSLSEALALLPPLQLYRRILRVHRRKLDPEMRILGDSYVKSEFRAHRNVENPLHIIGFLTEWQLYAQKLEGDAWVGEKLDKSKLDKMSDQQIGQLYELMQAIKNPEGEGKE
Mass
15 kDa
Simulated SDS-PAGE
Western blot of AFUA_2G05090 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AFUA_2G05090 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here