Protein expression services for GK15773 | Succinate dehydrogenase assembly factor 2-A, mitochondrial
Description
Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit of the SDH catalytic dimer.
Family
Belongs to the SDHAF2 family.
Species
Drosophila willistoni
Length
157 amino acids
Sequence
MLRQLNLTREISRWIFMPWQRGAAGTASAEPPALPINDVIVDYDGPDLPLPEYPQRPNEPLEIRKQRLVYQSRKRGMLENDLLLSTFAAKYLKNFNEEQTAIYDQLINGVSNDWDIYYWATDVKTTPAEYNTEIMQLLKEHVKNTERVQRFRQPDLT
Mass
18.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GK15773 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here