Description
Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit of the SDH catalytic dimer.
Family
Belongs to the SDHAF2 family.
Species
Drosophila grimshawi
Sequence
MVRSLLPLSWRRCASDSSNSSTNDDIIVDYDGPDLPLPEYPNRPNEPLGMRKQRLLYQSRKRGMLENDLLLSTFAHKYLKDFDEDETAIYDELINGVSNDWDIYYWATGVKPTPPQYETDIMELLKQHVKNTEKVARFRQPELTYYL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service