Secreted subtilisin-like serine endopeptidase (PubMed:25944934). Mediates the degradation of collagen, the major structural protein in the mammalian host. Degrades the nonhelical regions of collagen that function in the cross-linking of the helical components (By similarity). May function as virulence factor involved in epidermal wing necrosis observed in white nose syndrome (WNS) in bats (By similarity).

Belongs to the peptidase S8 family.

404 amino acids

MLFSKSLVALVACFLPLIVSATELKLRNAAATNVAADSYIVVYKDIDDSTFESEMFNVHSFLSKRDSTFRGLGHKYKMPKFKGYQIESDMDTVNRISQSPHVAYVDKDVKVSAYDLSVRIGAPWGLDRISHRNGTSPGLEEYTYDSSAGGGTTIYIIDTGVYIEHVEFEGRATFGANFIPGSPDTDEDGHGTHVAGIAAGANFGVASKAKIIAVRVLDANGDGKGSNVLAGMQWAADDAGKKNQTAKSVINMSLGADYSEAFNKATEAIIAKGIVVVAAAGNEDANASGVSPASTVDAITVGATDRNDSRAAFSNWGVALDVFAPGVDILSAWIGGKDANKTISGTSMACPHVAGLAAYFIGLEKNGTSTPSKIATKIKGVATKNVVLHPKNSRDNLAYNDDGY

42.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SP3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here