Description
Major secreted subtilisin-like serine endopeptidase. Preferentially cleaves substrates containing hydrophobic residues at P4, positively charged residues at P3, small or flexible residues at P2, and large, bulky residues at P1. Mediates the degradation of collagen, the major structural protein in the mammalian host. Degrades the nonhelical regions of collagen that function in the cross-linking of the helical components (PubMed:25944934). May function as virulence factor involved in epidermal wing necrosis observed in white nose syndrome (WNS) in bats (By similarity).
Family
Belongs to the peptidase S8 family.
Species
Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21)
Sequence
MKFSQSLIALAACFLPLIAAAPEEAQHAKIRSPGAQDIILDSYIVVFNKGVNDADIESEFASVSHILSKRRPAHKGVGHKYNITGFKGYQIETDTGSIGEIAASPLVAWIERDGKVQANALETRSGATWGLGRISHKATGSNSYVYDSSAGSGSTVYVVDSGIYIEHSEFEGRAKWGANYISGSPDTDENGHGTHCAGTIAGATYGVASKANLVAVKVLDGDGSGSNSGVIAGINFVGQNGKDGKSVLSMSLGGSYSAALNSAVESTISNGVTVVVAAGNDGADASNYSPASAKNAITVGAVDSTDTRADFSNYGSVLDVFAPGVDVKSAWIGSKSASNTISGTSMATPHVAGLAAYLIGLGGLSSPAAVASKIASIGIQGSVKDPKGSVNLIAYNGNGA
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service