Transcription factor involved in the induction of hypoxic gene transcription when the cells are shifted from aerobiosis to anaerobiosis. Involved in sterol uptake.

Belongs to the SUT1 family.

299 amino acids

MSTSITVRNRDRSLPPLLLPNVSLLEKDIRRKGTQNVGITDPELLSTTWTRKRAFPTDELLGGYKRLKPAAADSNECAIGIATVTPPPTLPVSAIVPPPQNYTPPLFEYHPHALASMVNEDANASCTQMSIISRSTSNSTTSSATSTSSISKRQRSGPSCDKCRLKKIKCNAKIEILLQDDTIMPMISNKLRYVLTPDDIRLYRGTLLRNIAIPDDVIEGTGSRKLIKHIDKLVLLTPCLPCIKKKHSSSSTNFPKNDKCTFSKGFTRADINISSKISLKFKDKTIYDITYDDYKSIDF

33.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SUT1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here