Plays a role in the inhibition of host complement-mediated lysis and serum bactericidal activity by interacting with complement component C5 (PubMed:23797068). Affects all three pathways of complement activation and inhibits the cleavage of C5 by preventing its binding to C5 convertases. In turn, prevents C5a-mediated neutrophil migration (By similarity).

Belongs to the staphylococcal/streptococcal toxin family.

231 amino acids

MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQNHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEVSLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI

26.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ssl7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here