About Products Protein Database Contact

Protein expression services for EnP1 | Spore wall and anchoring disk complex protein EnP1

Description
Spore wall protein involved in the adhesion to host cells surface glycoaminoglycans (GAGs). Microsporidian spore adherence is an integral part of activation and host cell invasion which requires the extrusion at the spore apex of a very long and coiled structure, the polar tube, through which the sporoplasm is pushed to enter into the potential host cell.
Species
Encephalitozoon cuniculi (strain GB-M1)
Length
357 amino acids
Sequence
MKLLGFLIVGLSAISALKTKALHLTCEQELRPYSAVVDANCMAFALNGSNIHEAIKYLQAMNIKKAYVLYWNDHDLRGTPMVLYDNGALAPFDPYTNTAKYVLCVEACPCPGSKAASVGGFQAATSSEKIYVEGSARPAQCSEVCIEPVERRPHYKKIVVNPSPSNCIPCEPECYDSSSSSECNKKRCKTFPRICKEKCGSRRRGCPRKVEVLKSQKTYTFDIEKYRRRGEVVVRVCSKDSKEKFERFILSRNGEIRGNNNKNCILEPLPKCLRCPGQLHKLKKHIERKVCQEVCMYINAKCDIFVLVGDCDFYRVVVNDRRRYRNLHLKKVRGHKLRELIKHGLFGVEFGPLDLDR
Mass
40.6 kDa
Simulated SDS-PAGE
Western blot of EnP1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make EnP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here