Involved in repair of UV radiation-induced DNA damage during spore germination. Can repair thymine dimer 5-thyminyl-5,6-dihydrothymine (known as spore photoproduct (SP)) by in situ monomerization of SP to two thymines.

Belongs to the radical SAM superfamily. SPL family.

342 amino acids

MQNPFVPQLVYIEPRALEYPLGQELQDKFENMGIEIRETTSHNQVRNIPGKNHLQQYRNAKSTLVIGVRKTLKFDSSKPSAEYAIPFATGCMGHCHYCYLQTTMGSKPYIRTYVNVEEILDQADKYMKERAPEFTRFEASCTSDIVGIDHLTHTLKRAIEHFGQSDLGKLRFVTKFHHVDHLLDAKHNGKTRFRFSINADYVIKNFEPGTSPLDKRIEAAVKVAKAGYPLGFIVAPIYIHEGWEEGYRHLFEKLDAALPQDVRHDITFELIQHRFTKPAKRVIEKNYPKTKLELDEEKRRYKWGRYGIGKYIYQKDEEHALREALESYIDTFFPNAKIEYFT

39.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make splB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here