Central component of the spindle assembly checkpoint which is a feedback control that prevents cells with incompletely assembled spindles from leaving mitosis. Plays a key role in virulence, probably through cell cycle checkpoint functions, especially those monitoring the integrity of DNA and chromosome segregation, which might be required for the pathogen to repair damage caused by host defense.

Belongs to the MAD2 family.

214 amino acids

MPSSLEPSSKLALKGSSKIVCDYFEFALNSILYQRGIYPQEDFVTVKKYDLPMVINDDYDVQKYINNIMKQIKKWIYGSLMSKFIIVIVSKTNLENIERWEFNIETKDQEETTENGDGDGDGVGKSRQEIQKEIRTIIRQITSSVSYLPVLKDDDEYTFNVLVYTDPNTSVPIEWCDTQGDGKVLDGDNVDNVKFTSFSTDIHQVGTSVSYKYE

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MAD2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here