Description
Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.
Family
Belongs to the SKA1 family.
Species
Xenopus tropicalis
Sequence
MDPGDLDELCSHVNSKISLIKKTLQLRNIGQDPSLNSVLSKIAFEMHSLYNLLNNLETEVQRQETIANSLRELQATVERDFTEASHLKENIPPHLPKRTQSSSSAPDEAPEMVVKVAAPEPAKKPSKEKPIKEMELITVHEFGTVPAYMKNRLTYEQINNIIEELNKAVVGKYKILHQPLKSLSNQARKQLSRYKEEETKDTKGQFFIVDQDIKDFTQVKVDKRFHGMLSILRHCHRLREIRGKGLVRYIIC
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service