About Products Protein Database Contact

Protein expression services for Ska1 | Spindle and kinetochore-associated protein 1

Description
Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.
Family
Belongs to the SKA1 family.
Species
Mus musculus
Length
254 amino acids
Sequence
MDSELEDLCSYVNEKIGNIKKILSIRNLGQDPALKTTLSKIGDEIIAVNELLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTATQSLVHKPEPDPKESDKAEEPGLPKKPPREQRVIKEMQFITMDEFSDVPAYMKSRLTYCQINDIIKEINKAVVSKYKIMHQPKASMSSVKRNLYQRFINEETKDTKGHHFIVEADIKEFTALKVDKRFYVIMHILRHCHRLSEVRGGGLTRYVIT
Mass
29.4 kDa
Simulated SDS-PAGE
Western blot of Ska1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Ska1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here