Component of the ceramide synthase complex required for C26-CoA-dependent ceramide synthesis. Facilitates ER-to-Golgi transport of GPI-anchored proteins (By similarity). Has a role in meiosis.

Belongs to the sphingosine N-acyltransferase family.

384 amino acids

MGNNTSRRSQSQKFKNIPSISAGSFSTMPVQHRGRRRRSKSIVGRAAQNAVLRSKEKTWIVPLILLTLLVGWYFVNPNGYIKYGIFLSYPIPGTNPAQYGKGRLDIAFCLFYALFFTFCREFIMQEIIARIGRHFNIRAPAKLRRFEEQAYTCLYFTVMGSWGLYVMKQTPMWFFNTDAFWEEYPHFYHVGSFKAFYLIEAAYWIQQALVLILQLEKPRKDFKELVVHHIITLLLIGLSYYFHFTWIGLAVFITMDTSDIWLALSKCLNYVNTVIVYPIFVIFVFVWIYMRHYLNFKIMWAVWGTMRTINSFDLDWAAEQYKCWISRDVTLILLTALQLVNIYWLILILRIGYRAFTTNDTHDERSEDEDEEVSDEKSSAKKND

45.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lac1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here