Catalyzes the hydrolysis of sphingomyelin. Sphingomyelinases D are produced by some spider in their venoms, but also by arthropods such as ticks, or pathogenic bacteria and fungi. They might play a role in pathogenicity through different mechanisms, such as membrane destabilization and host cell penetration, but also pulmonary inflammation and cutaneous lesions.

Belongs to the fungal sphingomyelinase D family.

319 amino acids

MTPLLRTICAILCILIAVPLTFACPTKAGVSKQANKRPTYAIAHMVLDRKGLKDAIKNGANSVEIDIAAYKEGWWADHDIRGRSWGDSLEDMFKAVAKESKNIAFVWLDLKTPDMCSGATCNKDVLDPSKCKPKDKCSMNSLQELAQKILNPAGVRILYGFFGAGATDSAGFNYIQGNLKAGEAVCLSGEVENVLNVYKKKGRGVKPQQRVMDYGYTQLETGFGNCKEKGYNTCAGLRNGAKARDKGDVKRVFGWTSRVGDGERVGQLLDKAHVDGIIYGFAITRYYDHEDSRAAARDITQRVQKSDDRYMATGADKPW

35.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make HCBG_06705 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here