Stimulates cell division and progesterone secretion of bovine granulosa cells in vitro in a potent and dose dependent manner. This protein appears to be a potent growth factor with effects on ovarian granulosa cells.

Belongs to the spermadhesin family.

134 amino acids

MKLSSVIPWALLLSTATVDSMDWLPRNTNCGGILKEESGVIATYYGPKTNCVWTIQMPPEYHVRVSIQYLQLNCNKESLEIIDGLPGSPVLGKICEGSLMDYRSSGSIMTVKYIREPEHPASFYEVLYFQDPQA

15 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SPADH1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here