Plays a role in the reorganization of the cytoskeleton, endocytosis and cellular vesicle trafficking, both during interphase and at the end of mitotic cell divisions. Required for efficient progress through mitosis and cytokinesis. Required for normal formation of the cleavage furrow at the end of mitosis. Modulates endocytosis of cell-surface proteins. Promotes membrane tubulation (in vitro). May promote the formation of macropinosomes (By similarity).

Belongs to the sorting nexin family.

549 amino acids

MALKARALYSFQGENKEEINILENEELHLFSDVSLDGWLQGTNSRGQTGLFPASYVEILRPRSGSVQVDYSGHTQGYTDSPHQGSYDDDEEDDDDWDDWDDGQTVVDEPSGSNGVSRSQLQHHHHYPRPEYTHRPRPALERQDSIASGKRGSVVGRNLNRFSSFVRSGVEAFVLGDVPQFGGVSESHAIEMGPKGPQWKANPRPFSCSVEEPTKQTKFKGIKSYISYRLTPDPCNSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIQKRKRRLVLWMDHMTSHPVLSQYDGFQHFLSCQDEKQWKAGKRRAERDELVGASFLLTLQLPTEHQDLQDVEERVDVFKAFSKKMDENVLQLSSVVSELARKHLGGFRKEFQRLGAALQGLSHSFQLDPPYSSEPLVGAISHTGRTYEAVGEMFAEQPKNDQFRFLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMEQDEADGIRKRCRVVGFALQAEINHFHQRRLQDFKQAIQHYLKEQILFYRRVSQELEKTLHMYDDL

63.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make snx33 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here