May be involved in several stages of intracellular trafficking. Plays a role in protein transport from early to late endosomes. Plays a role in protein transport to the lysosome. Promotes degradation of EGFR after EGF signaling.

Belongs to the sorting nexin family.

344 amino acids

MATPYVPVPMPIGNSASSFTNNRNQRSSSFGSVSTSSNSSKGQLEDSSVGTCKHTNVQDQMDSASSVCGSPLIRTKFTGTDSSIEYSARPRDTEEQHPDALNWEDRPSTPTILGYEVMEERAKFTVYKILVKKSPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYHLQRELLEKQKEVESLKKLLGEKQLHIDALETRIRTLSLEPGASLYVSRAEGGQILRVQSSVLQVNRDVLDEESRADHKPHFNSREAGSAIADIEVAQLAYNAEDD

38.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Snx16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here