Plays a role in vesicular protein sorting. Acts at the crossroads between the secretory and endocytic pathways. Is involved in the endosome to vacuole protein transport via its interaction with the BLOS1/2 proteins and, as component of the membrane-associated retromer complex, is also involved in endosome-to-Golgi retrograde transport. Required for the auxin-carrier protein PIN2 sorting to the lytic vacuolar pathway and the trafficking of several plasma membrane proteins. Also involved in the efficient sorting of seed storage protein globulin 12S.

Belongs to the sorting nexin family.

402 amino acids

MESTEQPRNISGSMQSPRSPSSHPYLSVSVTDPVKLGNGVQAYISYRVITKTNLPEYQGPEKIVIRRYSDFVWLRDRLFEKYKGIFIPPLPEKSAVEKFRFSAEFIEMRRAALDIFVNRIALHPELQQSEDLRTFLQADEETMDRFRFQETSIFKKPADLMQMFRDVQSKVSDAVLGKEKPVEETTADYEKLKHYIFELENHLTEAQKHAYRLVKRHRELGQSLLDFGKAVKLLGACEGEPTGKAFSDLGTKSELLSIKLQKEAQQVLMNFEEPLKDYVRYVQSIKATIAERGTAFKQHCELSETTKLKEINLDKLMLTRSDKVGEAEIEYREIKAESEEATRRFERIVKRMEDEIVRFQEQKTEEMGVAFHQFAKGQARLANSVADAWRSLLPKLEASYSV

46.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SNX1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here