Regulator of sister chromatid cohesion in mitosis stabilizing cohesin complex association with chromatin. May antagonize the action of wapl which stimulates cohesin dissociation from chromatin. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair. Required for efficient DNA double-stranded break repair (Probable).

Belongs to the sororin family.

269 amino acids

MSEGKKRSRGGLAIISPPKRRSQRKSTSDSPIPEPIMKRSITVKKIMPRKTLAAIVNTGSQSTPKVSNVPPAPRRSSRISPKIQKENAFSEQSQIVHKDVPGQSSAPKINVLSPIPVNIQLSPKQDNRDIIMSQKVRRSYSRLEMSLNSSSSLYSPTRKTDSSDTSTPNVVLKSGRSSLFGFDKLLNSEMPDGELKKSNGVTRKKNTKERILGTVLPEQPDHNIPGVVLAKQKRRKRKVAIIEKSDLDEWAAFMNAEFEEAEKFDLTVE

29.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cdca5-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here