Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation.

Belongs to the somatotropin/prolactin family.

209 amino acids

MASGFLLWPVLLVSFSVNAVEPISLYNLFTSAVNRAQHLHTLAAEIYKEFERSIPPEAHRQLSKTSPLAGCYSDSIPTPTGKDETQEKSDGYLLRISSALIQSWVYPLKTLSDAFSNSLMFGTSDGIFDKLEDLNKGINELMKVVGDGGIYIEDVRNLRYENFDVHLRNDAGLMKNYGLLACFKKDMHKVETYLKVTKCRRFVESNCTL

23.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gh1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here