About Products Protein Database Contact

Try expressing SLC35G5 in cell-free | Solute carrier family 35 member G5

Family
Belongs to the SLC35G solute transporter family.
Species
Pan paniscus
Length
338 amino acids
Sequence
MAGSHPYFNLPDSTHPSPPSAPPSLRWCQRCQPSDATNGLLVALLGGGLPAGFVGPLSRMAYQASNLPSLELLICRCLFHLPIALPLKLRGDPLLGPPDIRGRACFCALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTVCSAILTLCLESQGLSGYDWCGLLGSILGLIIIVGPGLWTLQEGTMGVYTALGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLFGLVGLLGFVPGLFVLQTPVLPSDLLSWSCVGAVGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYVLHETVAPFDITGAGIVLGSIAIITARNLSCERTGKVEE
Mass
35.2 kDa
Simulated SDS-PAGE
Western blot of SLC35G5 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing SLC35G5 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here