Involved in providing solanesyl diphosphate for plastoquinone-9 (PQ-9) formation in plastids (PubMed:15784989, PubMed:23913686) (Probable). Catalyzes the elongation of the prenyl side chain of PQ-9 in plastids (PubMed:23913686). Contributes to the biosynthesis of plastochromanol-8 (PC-8) in plastids (PubMed:23913686). Does not contribute to the synthesis of tocopherol or ubiquinone (PubMed:23913686). PQ-9 and PC-8 are lipophylic antioxidant that act as protectant against photooxidative stress under high light stress conditions (PubMed:23913686). Prefers geranylgeranyl diphosphate to farnesyl diphosphate as substrate (PubMed:15784989). No activity with geranyl diphosphate or dimethylallyl diphosphate as substrate (PubMed:15784989).

Belongs to the FPP/GGPP synthase family.

417 amino acids

MMMSCRNIDLGTSVLDHSCSSSSTSRRFLFGNSSKTVCMIGGRSCVGNLVFLRRDLATCRAVPAKSKENSLVNGIGQDQTVMLNLRQESRKPISLETLFEVVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAGLKELTVEHRRLGEIIEMIHTASLIHDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDVKLDDYMLKSYYKTASLVAASTKGAAIFSKVESKVAEQMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPAANDLAKGNITAPVIFALENEPRLREIIESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCLPRSGFRSALEDMVMFNLERID

46 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SPS2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here