Description
Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for methionine and for the branched-chain amino acids, particularly leucine, valine and isoleucine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent (By similarity).
Family
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A15 subfamily.
Sequence
MPKNSKVVKRDLDDDVIESVKDLLSNEDSVEDVSKKSELIVDVQEEKDTDAEDGSEVDDERPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLLVIGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWTLFYFSQSFQQPLPWDQCPLVKNASHTYIEPECEKSSATTYYWYREALAISSSISESGGLNWKMTGCLLAAWVMVCLAMIKGIQSSGKIMYFSSLFPYVVLICFLIRSLLLNGSIDGIRHMFTPKLEMMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKANIVNEKCISQNSEMILKLLKTGNVSWDVIPRHINLSAVTAEDYHVVYDIIQKVKEEEFAVLHLKACQIEDELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMFGTIEGIITPVVDTFKVRKEILTVICCLLAFCIGLMFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVSFVYGIDKFLEDLTDMLGFAPSKYYYYMWKYISPLMLVTLLIASIVNMGLSPPGYNAWIKEKASEEFLSYPMWGMVVCFSLMVLAILPVPVVFVIRRCNLIDDSSGNLASVTYKRGRVLKEPVNLDGDDASLIHGKIPSEMSSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMADMPDMPESDL
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service