About Products Protein Database Contact

Protein expression services for Slc6a15 | Sodium-dependent neutral amino acid transporter B(0)AT2

Description
Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for methionine and for the branched-chain amino acids, particularly leucine, valine and isoleucine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent (By similarity).
Family
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A15 subfamily.
Species
Rattus norvegicus
Length
729 amino acids
Sequence
MPKNSKVVKRDLDDDVIESVKDLLSNEDSVEDVSKKSELIVDVQEEKDTDAEDGSEVDDERPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLLVIGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWTLFYFSQSFQQPLPWDQCPLVKNASHTYIEPECEKSSATTYYWYREALAISSSISESGGLNWKMTGCLLAAWVMVCLAMIKGIQSSGKIMYFSSLFPYVVLICFLIRSLLLNGSIDGIRHMFTPKLEMMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKANIVNEKCISQNSEMILKLLKTGNVSWDVIPRHINLSAVTAEDYHVVYDIIQKVKEEEFAVLHLKACQIEDELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMFGTIEGIITPVVDTFKVRKEILTVICCLLAFCIGLMFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVSFVYGIDKFLEDLTDMLGFAPSKYYYYMWKYISPLMLVTLLIASIVNMGLSPPGYNAWIKEKASEEFLSYPMWGMVVCFSLMVLAILPVPVVFVIRRCNLIDDSSGNLASVTYKRGRVLKEPVNLDGDDASLIHGKIPSEMSSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMADMPDMPESDL
Mass
81.6 kDa
Simulated SDS-PAGE
Western blot of Slc6a15 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Slc6a15 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here