About Products Protein Database Contact

Protein expression services for slc5a8 | Sodium-coupled monocarboxylate transporter 1

Description
Acts as an electrogenic sodium (Na(+)) and chloride (Cl-)-dependent sodium-coupled solute transporter, including transport of monocarboxylates (short-chain fatty acids including L-lactate, D-lactate, pyruvate, acetate, propionate, valerate and butyrate), lactate, mocarboxylate drugs (nicotinate, benzoate, salicylate and 5-aminosalicylate) and ketone bodies (beta-D-hydroxybutyrate, acetoacetate and alpha-ketoisocaproate), with a Na(+):substrate stoichiometry of between 4:1 and 2:1. Catalyzes passive carrier mediated diffusion of iodide. Mediates iodide transport from the thyrocyte into the colloid lumen through the apical membrane (By similarity).
Family
Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
Species
Xenopus tropicalis
Length
620 amino acids
Sequence
MVTPGNIGSFTVWDYVVFALMLLISAVIGIYYAFAGGGQKTSKDFLMGGRSMTAVPVALSLTASFMSAVTVLGTPAEVYRFGSMFSIFAFTYAIVVVISSEVFLPVFYRLGITSTYEYLELRFNKFVRLLGTILFIIQTVLYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTMGGLKAVVWTDVFQVGIMVAGFSSVIIRAVVVQGGIGPILNDSYYGDRLNFWDFTPNPLQRHSFWTIVVGGTFTWTGIYGVNQSQVQRYIACKTRFQAKLSLYINLLGLWAILACAVLSGLAMYSIYKDCDPWTAQFVSAPDQLMPYLSLDILRDYPGLPGLFVSCAYSGTLSTVSSSINALAAVTVEDLIKPYFRSLSETKMSWISKGTSLIYGAICIAMAGLASLMGGLLQAALSIFGMVGGPLLGLFALGIIFPFVNSLGAVIGLLSGFAISLWVGIGSQIYPPTASSSLPKPLSLEGCNFTSFESNWTTTVMPMMTTLIPEVSSRPELADSWYSLSYLYFSTLGTIVAVVVGVIASLLSGGLKQNVNRDFLLTSQDFSYLNVLFSNCKKKGQEEKVEVLNWKMRSTDTDMDQGTDNPAFNHMEMSSTEKKEKMNGIIA
Mass
67.4 kDa
Simulated SDS-PAGE
Western blot of slc5a8 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make slc5a8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here