Description
Sodium-dependent GABA and taurine transporter. In presynaptic terminals, regulates GABA signaling termination through GABA uptake. May also be involved in beta-alanine transport (By similarity).
Family
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A13 subfamily.
Sequence
MDSRVSGTTSNGETKPVCPGLEKAAEDGALQREQWSNKMEFLLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFTCGIPVFLLETALGQYTSQGGITAWRKICPIFEGIGYASQMIVTLLNIYYIIVLAWALFYLFSSFTIDLPWGSCRHDWNTERCVEFQRTNGSLNATAENATSPVIEFWERRVLKISEGIQHLGALRWELALCLLLAWVVCYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTALGSYNKYHNNCYRDSIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREVLILGVSVTSFLVGLVMLTEGGMYVFQLFDYYAASGMCLLFVAIFESFCVAWAYGAGRFYDNIEDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYKYPWWGDALGWLLALSSMVCIPAWSCYKLSTLKGSFRERVRQLLCPAKDLPQGHREGPSAPATPRTSLLILTELEPHH
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing SLC6A13 in a
cell-free protein expression systems? We have solved
cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.
Order Here