Functions as an U snRNP-specific nuclear import adapter. Involved in the trimethylguanosine (m3G)-cap-dependent nuclear import of U snRNPs. Binds specifically to the terminal m3G-cap U snRNAs.

Belongs to the snurportin family.

365 amino acids

MEELCAALAGGVALAAPNSPAAPHPRLSAYKGRGDRLGQAERRRRLLCLQRERRLDYVNHARRLAEGDWAGVESDEDGGEDGDGEEEMEVDAGRRLPKRYANQLMLSEWLVDVPVDLEQEWIVVVCPVGKRALVVASRGSTAAYTKSGFCVNRFPSLLPGGNRHNTMNEKVYCILDCIYNEAEQTYYILDVMCWRGHPVYDCQTDFRFFWLSSKIQEEEGLGEKSRINPYKFVGLQNFPCTSESLCEVLTTNFPFEVDGLLFYHKQTHYTPGSTPLVGWLRPYMVPDILGLTVPATPLTAKPDYAGRQLQQIIESKRSKKLAAGKAQPSAEAAARNGHYELEHLSTPQPANSAQGQEEAGSQMEN

40.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SNUPN using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here