C-type natriuretic peptide: exhibits hypotensive and vasodepressor activity. Acts by activating natriuretic receptors (NPR1 and/or NPR2 and/or NPR3) (By similarity).

In the C-terminal section; belongs to the natriuretic peptide family.

302 amino acids

MSVSRLAASGLLLVSLLALALDGKPVEKWSPWLWPPRPRPPIPPLQQQKWLDPPIPQQQKWLDPPIPQQQKWLDPPIPQQQKWLNPPIPQQQKWLDPPIPQQQKWLNPPIPQQQKWLNPPIPQQQKWLNPPIPQQQKWLNPPIPQQQKWLDPPIPQQQKWLDPPIPQQQKWLDPPIPQQQKWLNPPIPQQQKWLDPPIPQQQKWLDPPIPQQQKWLNPPIPQQQKWQRPLQPEVPSLMELHQERQKQGRMMHHDEDPGDAAEGPRRQKKEPGKPEGNGCFGKKIDRINAGFGCPKLPPSGGH

35.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Svmpi-Cce12 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here