Description
Regulatory subunit of the blood coagulation factor X- and IX-activating enzyme. The enzyme activates coagulation factor X (F10) by cleaving the Arg-Ile bond and is also able to activate coagulation factor IX (F9) and protein S (PROS1) by specific cleavage of Arg-Ile and Arg-Val bonds. May serve as an exosite by which the enzyme recognizes and binds to the Gla domain of factor X (F10) and factor IX (F9) in a calcium-dependent manner.
Family
Belongs to the snaclec family.
Sequence
MGRFISVSFGLLVVFLSLSGTGAGLDCPPDSSLYRYFCYRVFKEHKTWEAAERFCMEHPNNGHLVSIESMEEAEFVAKLLSNTTGKFITHFWIGLMIKDKEQECSSEWSDGSSVSYDKLGKQEFRKCFVLEKESGYRMWFNRNCEERYLFVCKVPPEC
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service