About Products Protein Database Contact

Protein expression services for sumo3 | Small ubiquitin-related modifier 3

Description
Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex sae1-sae2 and linkage to the E2 enzyme ube2i (By similarity).
Family
Belongs to the ubiquitin family. SUMO subfamily.
Species
Xenopus laevis
Length
94 amino acids
Sequence
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVC
Mass
10.7 kDa
Simulated SDS-PAGE
Western blot of sumo3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make sumo3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here