Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1. Involved in the regulation of the heat stress transcription factor HSFA2 in acquired thermotolerance.

Belongs to the ubiquitin family. SUMO subfamily.

100 amino acids

MSANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGGSGGGATA

11 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SUMO1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here