Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).

Belongs to the cornifin (SPRR) family.

108 amino acids

MSYQQQQCKQPCQPPPVCPPPQCPEPCPPPKCPEPCPPPKCTEPCPPPKCPEPCPPPKCPEPCPPPKCPEPCPPPKCTEPCPPPSYQQKCPSVQPSPPCQQKCPPKNK

11.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Sprr2h using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here