Negatively regulates T-cell antigen receptor (TCR)-mediated signaling. Involved in positive selection of T-cells.

180 amino acids

MSRDYNCTTDDQLAWGIPSISHAWGLWALLGVVTVLLLISLAALLSQWTRGRRRNQEGQGPLSGRSAEEVPLYGNLHYLQTGRLSQEPRSEEQDPPSSGGLARGAEEAMCYTSLQLRPAQGRIPSSGNPIKYCEVVLDSEPKPQAPGPEPELYASVCAQTRRGRASFPDQAYANSQPAPS

19.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Sit1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here