Description
Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal recognition particle (SRP) and the ribosome-nascent chain (RNC). Interaction with SRP-RNC leads to the transfer of the RNC complex to the Sec translocase for insertion into the membrane, the hydrolysis of GTP by both Ffh and FtsY, and the dissociation of the SRP-FtsY complex into the individual components.
Family
Belongs to the GTP-binding SRP family. FtsY subfamily.
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Sequence
MFKKRVFSWFGFKKNKTKINDLDDHIKKNNQDNLSQKKCNNICSQDSIAKSTKSDCCSENVANSSAVNESHSSSLMKLKLKQHVSHVNNKNSFLLTLTTKLVRTKEAFSIKLKNLFFKKKTYNSLLDDIEEQLLVSDIGVRTTRELVDSLIKVSTQHELKNLNLIIEILKSKMKKILNKVEGPLNINYKNLFVILVVGVNGVGKTTLIGKLAKNYKKKGKSVILAAGDTFRAAAIDQLKLWGEINSVSVITREIGSDPASVVYDAIKIAKLKCIDILIIDTAGRLHNKNNLMEELKKIKRVIHKIDSTISQETMLVLDACIGQNSIKQVKIFHESLNVTGLVITKLDSTAKGGVIFSIAQEFLIPVRYISFGEDFEDIQVFNSNIFVNAILSNNTLK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service