Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. It must be involved intimately in the translocation of a wide variety of protein substrates (By similarity).

Belongs to the SRP19 family.

310 amino acids

MAILEEIDDVDNMDFDPAEFDPRAVLTDATAHQESDGRGPINLISKAEHERREQAKKQQEQQQEQQQQANPMAQLQQMMDQMNQGGGMPPNMGQQGKPGTQVFDSEEFKNQEIQESDFKDWQIVYPVYFDKNKTVGEGRRVPLELAVENPLGQTIAEACKMLTLPSIYEAHKTHPKDWANPGRVRVQLKDDPALGLPPHSVKNKRHLFRLIAQYMKEHPTKEVTPYQGPVFQKIIQTNPEFPWNSKNLPPKPQYPRGWKMPEILPILSPALSHGEANNDMMEQMANQFMPKIPEAPPQQKVKKMKVRVGR

35.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SEC65 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here