Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

Belongs to the GTP-binding SRP family. SRP54 subfamily.

497 amino acids

MVLAELGGRIMSAIQKMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKEMQTNIKKIVNLEDLAAGHNKRRIIEQAIFSELCKMLDPGKSAFAPKKAKPSVVMFVGLQGEVLEKPQLVPSMLIIIRRKGYKPALVCADTFRAGAFDQLKQNATKSKIPYYGSYTGSDPVKIAVEGVDRFKKENCDLIIVDTSGRHKQQASLFEEMRQISEATKPDLVIFVMDSSIGQTAFEQARAFKQTVAVGAVIITKMDGHAKGGGTLSAVAATKSPVIFIGTGEHMDEFEVFDAKPFVSRLLGNGDMSGFVNKLQEVVPKDQQPELLEMLSHGKFTLRIMYDQFQNMLNMGPLKEVFSMLPGMRAEMMPEGHEKESQAKIKRYMTMMDSMTNEELDSSNPKVFNESRIMRIARGSGRIVREVMEMLEEYKRLTTMWGKVKGLKNLEKGNMSALSKNKNSQQLSKVLPAQMLKQIGGMSGLQSLMKQMGSGKDLMGMFGGRDE

55.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SRP-54B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here