Functions in tapetum development during early meiosis. May play a role in the endoplasmic reticulum (ER) membrane in the early stages of tapetum development in anthers. Seems to function after MSP1 and before UDT1.

Belongs to the SPCS1 family.

112 amino acids

MGRDEMLRRSLVALAAAVVVTGVVTASVRKAAATYGFGILAIAGVLLPDWEFFDRDYSQWLTPMPASRRTAAEAAADREHDVWKFKPYPLRMAMLTTIYGFGLYKWWMYVSS

12.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DTM1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here